PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06761g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 424aa    MW: 46837.9 Da    PI: 5.8261
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06761g00018.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78.4e-083734062154
                               HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               k +yp++e++++L +++gL+ +q+ +WF N+R +
  Niben101Scf06761g00018.1 373 KWPYPTEEDKAKLVQETGLQLKQINNWFINQRKR 406
                               569*****************************87 PP

2ELK27.76.3e-10327348122
                       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                               ELKh+L+++Y+++L+++++E++
  Niben101Scf06761g00018.1 327 ELKHELKQGYKEKLVDIREEIL 348
                               9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.2E-18165209IPR005540KNOX1
PfamPF037906.3E-17167208IPR005540KNOX1
SMARTSM012564.0E-28217272IPR005541KNOX2
PfamPF037911.4E-20221271IPR005541KNOX2
PROSITE profilePS5121310.144327347IPR005539ELK domain
SMARTSM011889.2E-4327348IPR005539ELK domain
PfamPF037892.2E-6327348IPR005539ELK domain
PROSITE profilePS5007111.742347410IPR001356Homeobox domain
SuperFamilySSF466894.28E-16349413IPR009057Homeodomain-like
SMARTSM003891.8E-11349414IPR001356Homeobox domain
CDDcd000867.90E-12350411No hitNo description
Gene3DG3DSA:1.10.10.603.1E-25354411IPR009057Homeodomain-like
PfamPF059201.0E-17367406IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MAYNPNHMSQ EMDMHHFSDE NSAVLRSILP EQLAQSSPDV KPLDHQQPAT WLNSAILRQE  60
SHYTSTGGCG AGENFLNLHS NSESSAAASQ ASNQWLSRSI LQRNVSDVQT SNNSSAVMAA  120
VDLKNDDGNN NNDSGNNAAA GQLTDSKVVG GGGGGTDGIL NWQNAGYKAE ILAHPLFEQL  180
LSAHVACLRI ATPVDQLPRI DAQLAQSQQV VAKYSSLGQN IGDDKELDQF LTHYVLLLCS  240
FKEQLQQHVR VHAMEAVMAC WEIEQSLQSL TGVSPGEGTG ATMSDDEDDQ VDSEANLFDG  300
SLVGHDGMGF GLPTESERSL MERVRQELKH ELKQGYKEKL VDIREEILRK RRAGKLPGDT  360
TSVLKAWWQS HAKWPYPTEE DKAKLVQETG LQLKQINNWF INQRKRNWHS NPSSSTTSKS  420
KHKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A5e-13350414872Homeobox protein PKNOX1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618001.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_009618002.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_009618003.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
RefseqXP_016464581.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_016464582.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLO658500.0O65850_TOBAC; NTH23 protein
STRINGPGSC0003DMT4000403510.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-176KNOTTED1-like homeobox gene 3